Read the sentence: "You don't have to reimburse
me for dinner it's my treat."
Which option shows the best place to add a
semicolon to the sentence?
Select one:

Read The Sentence: "You Don't Have To Reimburseme For Dinner It's My Treat."Which Option Shows The Best

Answers

Answer 1

The correct answer is D. You don't have to reimburse me for dinner; it's my treat.

Explanation

The semicolon (;) is a punctuation mark made up of a period superimposed on a comma. Experts consider the use of this sign to be subjective. One of its main uses is to separate sentences with semantic relationships, which is used when two sentences are joined without a conjunction. An example of this is "You don't have to reimburse me for dinner; it's my treat" because it is separating two sentences that do not have conjunction that relates them, but that are related. So the correct answer is D. You don't have to reimburse me for dinner; it's my treat.


Related Questions

can anyone help with these underline the verb and.....​

Answers

first one is changed

Explanation:

second one is doing

Fill in the correct wo A number of girls..... fighting in school. (was, were, have)​

Answers

Answer:

A number of girls "were" fighting in school.

Explanation:

A number of girls was fighting in school.

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

Read and classify each selection as a topic or a thesis. Drag the items on the left to the correct location on the right.
topic
thesis

Answers

Answer:

topics

snowboarding

climbing mt Everest

the rest are all categorized as thesis

How can you show emotion in formal writing?\
by using question marks

by using emoticons

by using exclamation points

by using periods

plsssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss answer with one of the options

Answers

Answer:

by using exclamation points

Explanation:

Formal writings are writing styles adopted for use in professional, academic and other setting which does not involve a personal level of interaction. Therefore, formal writing setup are more organized and guided than informal writings. In formal writeups, there may also be need to show emotions such as excitement, happiness, surprise a d so on. If it were in an in formal setting the use of emoticons would be a very good way to show emotions due to the various emoticon labels available. However, the use of an exclamation mark (!) may be adopted in formal writing to express emotions. In many texts, the use of one (!) rather than three (!!!) is more appropriate for formal writings.

Which of these uses pathos?

Answers

c. makes them feel guilty

Mr.Thapa visits his sister once a month.(how often question)

Answers

Answer:

How often does Mr. Thapa visit his sister?

Explanation:

Changing a sentence/ statement into a "how often" question means that the sentence will be a question and must be correctly punctuated with a question mark. Also, the question will start with the "how often" phrase and pose a question that the time phrase will answer.

This means that the time phrase "once a month" is the answer. Therefore, the question will be framed according to the answer. Also, the tense of the given sentence is simple present tense. So, the question form will also have the present tense.

Thus, the correct answer will be

How often does Mr. Thapa visit his sister?

Use the poem to complete the sentences.



The first four lines of the poem make up a

.

The last two lines of the poem make up a

.

Answers

Answer:

quatrain

couplet

Explanation:

In poetry, a quatrain is a group of four lines that constitutes one stanza, or verse, of a poem. A quatrain can be a separate poem on its own or a portion inside a greater poem. The lyrical expression is taken from the “four”-meaning French word “quatre.”

What impact of couplet and quatrain in poem?

Typically, a couplet comprises two lines that follow each other, rhyme, and have the same meter. A couplet can be run-on or formal (closed) (open). Each of the two lines of a formal (or closed) couplet is end-stopped, suggesting that there is a grammatical pause at the conclusion of a line of verse.

A couplet is a literary technique composed of two lines of poem that rhyme. These occur consecutively or one after the other. The meter, or the number of syllables and stresses, of these lines is typically the same. Together, these two lines frequently complete a notion or make a statement.

Therefore, The first four lines of the poem make up a quatrain and

The last two lines of the poem make up a couplet.

Learn more about poem here:

https://brainly.com/question/14660674

#SPJ2

do well; do what you tried to do

Answers

yeah what he said yea

Which of the following is the main reason that eating local food helps the environment? (Please help!!)

A. It travels more miles.
B. It is less nutritious.
C. It is more nutritious.
D. It travels fewer miles.

Answers

Uh I think it could possibly be D

The fundamental reason why consuming locally produced food is beneficial to the environment is given in option (D): " It travels fewer miles"

What are the benefits of eating local food?

Local food helps to keep the local economy afloat because local food does not have to travel as far to reach your plate, it contributes to lowering greenhouse gas (GG) emissions and improving our carbon footprint.

It improves and aids the local economy by supporting local producers, farmers, and other producers.

Check out the link below to learn more about local-food benefits;

https://brainly.com/question/20898394

#SPJ2

in “The Cask of Amontillado,” which statement best infers the value that Montresor places on his reputation?

Answers

Yes i enes resputatoon

Which statements provide a logical analysis of the call
to action in Queen Elizabeth's speech? Select all that
apply.
The context of awaiting an attack establishes
expectation and adds reasonability.
O The emotional language makes the audience
unlikely to support her request.
The argument builds to the call to action by
establishing the situation and eliciting strong
emotions.
O The failure to establish logos makes the queen's
request seem unreasonable.
O Though the queen asks the troops to risk their lives,
the call is appropriate given a soldier's duty.

Answers

Answer:

A,C,E

Explanation:

edge 2021

The students were interviewed by the reporter


Rewrite the sentence using active voice.

Answers

Answer:

The reporter had interviewed the students

the reporter interviewed the students

Two minutes speech on online classes

Answers

Answer:

???????????what are you asking for

Pyramus had left a little later than his Thisbe had, and he could see what surely were the tracks of a wild beast left clearly on deep dust. His face grew ashen. And when he had found the bloodstained shawl, he cried: 'Now this same night will see two lovers lose their lives.' —"Pyramus and Thisbe," Ovid Which statement best describes how the order of events heightens tension in this passage? If Pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion. If the lioness had arrived later, she would have encountered Pyramus rather than Thisbe. If Pyramus had arrived earlier, he would have seen the lion attack Thisbe. If Pyramus and Thisbe had arrived at the same time, they would have encountered the lioness together.

Answers

Answer:

Hello, I believe the answer is if pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion.

Answer:

A is correct

Explanation:

Got it right on edge

He sold many oranges (Passive voice )​

Answers

Many oranges were sold by him

choose the implied meaning of burn the candle at both sides ​

Answers

it means that when something good or bad is happening the candle will hold good and bad and in many situations you will be in the middle cuz nothing ever only holds bad

Hi you can help me plissss

Answers

Answer:

Racism, discrimination, and prejudice

Explanation:

Racism is the belief that groups of humans possess different behavioral traits corresponding to physical appearance and can be divided based on the superiority of one race over another.

Discrimination is the act of making unjustified distinctions between human beings based on the groups, classes, or other categories to which they are perceived to belong. People may be discriminated against on the basis of race, gender, age, religion, or sexual orientation.

Prejudice can be an affective feeling towards a person based on their perceived group membership. The word is often used to refer to a preconceived evaluation or classification of another person.

Racism: There are two main types of racism. The first is individual racism, which stems from one’s subconscious biases against those of another race. The second is systemic racism, which is the implementation of policies that result in the disproportionate inequality (whether this be financial, social, etc.) of specific racial groups, whether or not this is the indent of the policies.

Discrimination: This is the direct mistreatment of people based on specific things about a person or group, such as race, gender, sexual orientation, nationality, age, etc.

Prejudice: This is the preconceived notion that someone of a certain group is inferior simply because they are a part of this group. This may or may not result in discrimination.

… these things are important not because a high-sounding interpretation can be put upon them but because they are useful. When they become so derivative as to become unintelligible, the same thing may be said for all of us, that we do not admire what we cannot understand —"Poetry," Marianne Moore de riv a tive noun — something based on another source Based on context and the definition above, what does derivative mean in this poem? A. Lacking originality B. Relating to a contract C. Made from another substance D. Something expensive

Answers

Answer:

Lacking Originality

sorry it's late

1st one: A, Lacking Originality

2nd one: B, An unoriginal poem is not worthwhile.

Read the excerpt from Ovid’s "Pyramus and Thisbe".

Theirs did—indeed they wanted to be wed,
but marriage was forbidden by their parents;
yet there's one thing that parents can't prevent:
the flame of love that burned in both of them.

What story element is most evident in the excerpt?

the characterization of Thisbe
a description of setting
an introduction of theme
the events of the plot

Answers

Answer: C - an introduction of theme

Explanation:

Answer:

an introduction to theme,C

Explanation:

edge 2021

What does the color "gold" represent in the poem ?

This is the poem

Nature’s first green is gold,


Her hardest hue to hold.


Her early leaf’s a flower;


But only so an hour.


Then leaf subsides to leaf.


So Eden sank to grief,


So Dawn goes down to day.

Nothing gold can stay.


This is the option

A. The speaker's greed

B. The speaker's dreams

C. The slow passage of time

D. The fleeting nature of beauty.

Please no links I need help really bad! I know it not C by the way

Answers

Answer:

It is D

Explanation:

This is because he is saying that gold does not stay. The nature of beauty can also relate to this.

And also it is because I got the same question a week ago on my test

Answer:

it is answer D the fleeting nature of beauty

"Think of all the beauty that’s still left in and around you and be happy."
—from The Diary of Anne Frank by Anne Frank

Even in difficult circumstances, some people focus on the positive aspects of life. Think carefully about this statement.

Write an essay stating your opinion on whether a person can choose to be happy. Be sure to —
• state your position clearly
• use appropriate organization
• provide specific support for your argument
• choose your words carefully
• edit your writing for grammar, mechanics, and spelling


Answers

Answer:

A person can absolutely choose to be happy. It is often easy to look at someone like Anne Frank and say that she was in a situation where one can't be happy. But, Anne Frank has showed us that happiness is not reliant upon circumstance. In incredibly difficult circumstances one has every right to feel negative emotions. The most important thing is that we remember that even though we experience negative emotions we shouldn't let them overrun us. We should accept our circumstances, experience our emotions,and then choose happiness.

Hey can you guys help me please!! I need this really bad. What are two overarching messages in the novel Illegal? Please help me. I need lots of help!

Answers

The main "Illegal" messages are the relationships between privilege, power and race. This can be seen in social relations in relation to race, as the story takes place in a universe where white-skinned people have guaranteed citizenship, have power social and economic, the freedom to act as they please, and all the perks that a system can promote. The black population, on the other hand, does not have this citizenship and is devalued, oppressed, exploited and even deported and killed.

"Illegal" presents the story of a society in a fictional country called the Freedom State. Despite the name, the country lives in a system of constant oppression, where the entire society is subject to governmental control, which determines who is legal within the country and those who are illegal and must be fought.

Which revision of this section of dialogue best shows the narrator’s feelings? When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility. When I first open the notebook, I take care to crease the cover gently so that it’s nice and flexible, and then I can enjoy writing without fussing. I’m happy about the notebook because now I can get started on writing down the song that’s been floundering in my head all week. I’m glad to have a new notebook because I’m hoping it will provide inspiration to start working on that short story that’s due in English soon.

Answers

Answer: When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility.

Explanation:

The revision of this section of dialogue best shows the narrator’s feelings is "When I open the cover, the smell of fresh paper wafts up to greet me and the crisp, open page fills me with an exquisite sense of possibility".

This implies how the narrator feels about how he feels like whenever he wants to start a new notebook.

Answer:

its a

Explanation:

will give correct answer brainliest​

Answers

I think the answer is C sorry if im wrong!

The girls (talk) during the class yesterday.
____________________________________________________
b) My sisters (laugh) at my story.
____________________________________________________
c) While he (clean) the house, we (cook).
____________________________________________________
d) It was a lovely day. The sun (shine) and the birds (sing) in the trees.
____________________________________________________
e) I lost my keys when I (walk) home.
____________________________________________________
f) I (knit) sweater when the puppy took away the ball of wool.
____________________________________________________
g) Papa (drink) tea when the newspaper boy arrived.
____________________________________________________
h) Talha (watch) TV when the phone rang.
____________________________________________________
i) Shan (drive) fast when he hit the woman.
____________________________________________________
j) When I woke up, it (rain).
____________________________________________________
k) I (have) dinner when I heard a loud noise.
______________________________
convert into past continious

Answers

Answer:

A) Talked

B) Laughed

C) cooked

D)  Shined

E) walked

F) knitted

G) Drank

H) Watched

I) Drove

J) Rained

K) Had

MARK THIS ANSWER AS BRAINLIEST PLEASE!

The girls were talking during the class yesterday.

My sisters was laughing at my story.

While he was cleaning the house, we were cooking.

It was a lovely day. The sun was shining and the birds were singing in the trees.

I lost my keys when I was walking home.

I was knitting sweater when the puppy took away the ball of wool.

Papa was drinking tea when the newspaper boy arrived.

Talha was watching TV when the phone rang.

Shan was driving fast when he hit the woman.

When I woke up, it was raining.

I was having dinner when I heard a loud noise.

What is the meaning of quetzal?​

Answers

Answer:

Quetzals are a colorful type of bird belonging to the trogon family. They are reportedly said to be found in forests especially in the humid highland regions. These birds usually have red colored bellies, and their heads and back usually colored in green or golden color. Due to the vibrant color scheme possessed by Quetzals, they have been adopted as the national bird of Guatemala. Different Quetzals species have been reportedly found in Mexico, The United States and Guatemala. Quetzals mostly feed on insects, berries and fruits.

Explanation:

Kindly check answer.

5 questions with Do and 5 questions with Does english english english plss i dont speak english please help

Answers

Answer:

1. Do you have a book?

2. Do they live here?

3. Do we have a Roku remote?

4. Do we have any milk?

5. Do they really think that's correct?

1. Does anyone have a pencil?

2. Does the pet shop have any crickets?

3. Does anyone know where we are?

4. Does the cafe open at ten or eleven.

5. Does Teresa have a bad back?

Explanation:

Answer:these all end with a question mark

Explanation:

1.do you love people.

2.do you know what time it is?.

3.do chicken fly?

4.do you want to come over?.

5.do the same people always sit.

6.does he have the pen.

7.does she write

8.does he hate gabriella.

9.does jewels know she is mean.

10.does she even read her notes

1: Do Stan and Jill make a good pair? Tell why you
think so.

Answers

Answer:

uhhh maybe?

Explanation:

I dont know if this is for a class or just like to prove a point but.... I'm going with maybe?

Need help with and essssayyyyyyyyy

Answers

Answer:

Essay on a story called "David Copperfield"

The full title of “David Copperfield” is “The Personal History, Adventures, Experience and Observation of David Copperfield the younger of Blunderstone Rookery” but it was never published under this name. “David Copperfield” is the story of a child carrying the same name and his journey from childhood till he grows old.

A sad childhood is portrayed in the story where the child loses his father at a young age. As a result, his mother marries again and his step father gives the little child a very hard time. His step father believes that being weak in studies, David needs full attention. After being frustrated by his father, little David one day bites him. The result is that soon he lands into a hostel where he also faces a hard time but makes two friends- James Steerforth and Tommy Traddles. When he returns home during vacations he comes to know that his mother has given birth to a baby boy. Soon both his mother and the baby boy dies and David is left alone to face the torture of his father. His father now sends David to a factory to work.

David runs away from London to Dover and now meets his relative, Aunt Betsey Trotwood. He is now renamed as Trotwood Copperfield and is addressed by the new nickname Trot everywhere. As he grows up many of his loved ones also leave him alone by kissing death including his Aunt Betsey. At a very young age David faces the pain that people do not face in their lifetimes. This makes him a mature and well to do individual. But life takes a much harder lesson after he gets married to Dora Spenlow because she dies facing the pain of her miscarriage early in their marriage. Later David marries the beautiful and sensible Agnes and lives a beautiful life with her and their three children. He also names his daughter after his late aunt Betsey to show how much he loved her and how much he still misses her.

Is this story okay ??if you want an essay on the story which you read ,then please ask , if I know the story I would try to help

Thank you

Other Questions
Please help me I would really appreciate it, If you can't that is okay but please try! simplify the expression i need help with this question This is my hw. heelp A storage container in the shape of a square-based prism has a volume of 120 ft. If the sides of the square base are 4 ft in length, determine the height of the container. Question 5 of 30 Which statement provides the best description of the relationship between primary consumers and producers? O A. Producers and primary consumers compete with each other for food sources. B. Primary consumers eat secondary consumers, which rely on producers for food. C. Producers provide primary consumers with the chemical energy they need. D. Primary consumers provide producers with the chemical energy they need. what is wartime speech by sir winston churchill about? up to 2 paragraphs please Please help Ill give brainliest Help me with numbers 44 and 45 Can yall help me on question 28?! given m||n, find the value of x I NEED HELP PLEASE ITS A SOLVE FOR X PROBLEM :( For the sequence an = an-1 + an-2 and ai = 2, a2 = 3,its first term isits second term isits third term isits fourth term isits fifth term is Give solutions to prevent landslide and soil erosion using the concept of how nature mitigate soil erosion. Explain your solution. Please help me with my homework! It is a poem called The Road Not Taken.Based on the information in the poem, why might the second road have "wanted wear" and been "grassy?"A. because the second road was close to a stream that ran through the woodsB. because the second road got a lot of sunlightC. because many people had taken the second roadD. because few people had taken the second roadPlease choose the correct answer. How much of the population is employed in agriculture?5%10%20%40% Find the volume of this prism. if the orginal quantity is 15 and the new quantity is 19 estimate the percent change of which of these is the best esitmate for the percet change A. 25% DECREASEB. 5% DECREASEC 25% INCREASED 5% INCREASE Match the muscle with its type.1 deltoid: 2 triceps: .3 heart: . 4 sartorius: .5 intestine: . 6 veins: .7 biceps: .8 trapezius: .9 stomach: .10 gastrocnemius: .a cardiacb smooth c striated What is the exponent for the expression 6 x 6 x 6 x 6 x 6?