HELP ASAP please :))

HELP ASAP Please :))

Answers

Answer 1

Answer:

image is blurry

Explanation:

the quality of your image is dreadful and needs better quality this can be accomplished by taking a simple screenshot. the way you preform this action is by simply clicking the icon on the upper right of your computer screen with the three dots simply click on it then hover your mouse over more tools then click take screenshot upload this screenshot to brainly and we will be more then happy to answer your question


Related Questions

Which of these uses pathos?

Answers

c. makes them feel guilty

will give correct answer brainliest​

Answers

I think the answer is C sorry if im wrong!

please help, everything is in the pictures. :}

Answers

Answer:

Paragraph 1: Despite the relatively recent age of the early shoes found to date, scientists believe that humans, were wearing shoes as much as 40,000 years ago.

Paragraph 2: Ancient Egyptians made sandals from papyrus and palm leaves.

Paragraph 3: Today, shoe manufacturers use rubber, plastic, cloth, and other materials in addition to leather

Explanation:

which one is wrong?
a.fly-flew
b.send-sent
c.win-won
d.teach-thought​

Answers

Answer is D. Teach-thought

What does the color "gold" represent in the poem ?

This is the poem

Nature’s first green is gold,


Her hardest hue to hold.


Her early leaf’s a flower;


But only so an hour.


Then leaf subsides to leaf.


So Eden sank to grief,


So Dawn goes down to day.

Nothing gold can stay.


This is the option

A. The speaker's greed

B. The speaker's dreams

C. The slow passage of time

D. The fleeting nature of beauty.

Please no links I need help really bad! I know it not C by the way

Answers

Answer:

It is D

Explanation:

This is because he is saying that gold does not stay. The nature of beauty can also relate to this.

And also it is because I got the same question a week ago on my test

Answer:

it is answer D the fleeting nature of beauty

What is the meaning of quetzal?​

Answers

Answer:

Quetzals are a colorful type of bird belonging to the trogon family. They are reportedly said to be found in forests especially in the humid highland regions. These birds usually have red colored bellies, and their heads and back usually colored in green or golden color. Due to the vibrant color scheme possessed by Quetzals, they have been adopted as the national bird of Guatemala. Different Quetzals species have been reportedly found in Mexico, The United States and Guatemala. Quetzals mostly feed on insects, berries and fruits.

Explanation:

Kindly check answer.

Read and classify each selection as a topic or a thesis. Drag the items on the left to the correct location on the right.
topic
thesis

Answers

Answer:

topics

snowboarding

climbing mt Everest

the rest are all categorized as thesis

… these things are important not because a high-sounding interpretation can be put upon them but because they are useful. When they become so derivative as to become unintelligible, the same thing may be said for all of us, that we do not admire what we cannot understand —"Poetry," Marianne Moore de riv a tive noun — something based on another source Based on context and the definition above, what does derivative mean in this poem? A. Lacking originality B. Relating to a contract C. Made from another substance D. Something expensive

Answers

Answer:

Lacking Originality

sorry it's late

1st one: A, Lacking Originality

2nd one: B, An unoriginal poem is not worthwhile.

in “The Cask of Amontillado,” which statement best infers the value that Montresor places on his reputation?

Answers

Yes i enes resputatoon

Which statement best expresses the theme of "Wherefore Art Thou Romeo?”

A friend’s genuine help can actually cause one pain.
One must get along with everyone in order to succeed.
Sometimes, one’s weakness can become one’s strength.
In order to succeed, one must have an enemy to focus on.

Answers

A friend’s genuine help can actually cause one pain.

What is Wherefore Art Thou Romeo?

Shakespeare's tragedy Romeo and Juliet features a male lead named Romeo Montague (Italian: Romeo Montecchi).

He secretly loves and marries Juliet, a descendant of the rival House of Capulet, through a priest by the name of Friar Laurence. He is the son of Lord Montague and his wife, Lady Montague.

Romeo, who was exiled after killing Tybalt, Juliet's cousin, in a duel, by mistake, kills himself after learning the truth about Juliet's demise. The character's roots can be found as far back as Pyramus, who occurs in Ovid's Metamorphoses.

Therefore, A friend’s genuine help can actually cause one pain.

To learn more about Romeo, refer to the link:

https://brainly.com/question/19605913

#SPJ7

Pyramus had left a little later than his Thisbe had, and he could see what surely were the tracks of a wild beast left clearly on deep dust. His face grew ashen. And when he had found the bloodstained shawl, he cried: 'Now this same night will see two lovers lose their lives.' —"Pyramus and Thisbe," Ovid Which statement best describes how the order of events heightens tension in this passage? If Pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion. If the lioness had arrived later, she would have encountered Pyramus rather than Thisbe. If Pyramus had arrived earlier, he would have seen the lion attack Thisbe. If Pyramus and Thisbe had arrived at the same time, they would have encountered the lioness together.

Answers

Answer:

Hello, I believe the answer is if pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion.

Answer:

A is correct

Explanation:

Got it right on edge

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

He sold many oranges (Passive voice )​

Answers

Many oranges were sold by him

Fill in the correct wo A number of girls..... fighting in school. (was, were, have)​

Answers

Answer:

A number of girls "were" fighting in school.

Explanation:

A number of girls was fighting in school.

5 questions with Do and 5 questions with Does english english english plss i dont speak english please help

Answers

Answer:

1. Do you have a book?

2. Do they live here?

3. Do we have a Roku remote?

4. Do we have any milk?

5. Do they really think that's correct?

1. Does anyone have a pencil?

2. Does the pet shop have any crickets?

3. Does anyone know where we are?

4. Does the cafe open at ten or eleven.

5. Does Teresa have a bad back?

Explanation:

Answer:these all end with a question mark

Explanation:

1.do you love people.

2.do you know what time it is?.

3.do chicken fly?

4.do you want to come over?.

5.do the same people always sit.

6.does he have the pen.

7.does she write

8.does he hate gabriella.

9.does jewels know she is mean.

10.does she even read her notes

1: Do Stan and Jill make a good pair? Tell why you
think so.

Answers

Answer:

uhhh maybe?

Explanation:

I dont know if this is for a class or just like to prove a point but.... I'm going with maybe?

Read the excerpt from Ovid’s "Pyramus and Thisbe".

Theirs did—indeed they wanted to be wed,
but marriage was forbidden by their parents;
yet there's one thing that parents can't prevent:
the flame of love that burned in both of them.

What story element is most evident in the excerpt?

the characterization of Thisbe
a description of setting
an introduction of theme
the events of the plot

Answers

Answer: C - an introduction of theme

Explanation:

Answer:

an introduction to theme,C

Explanation:

edge 2021

Punctuate this:
Its not fair said Angus toms allowed to go,why cant I​

Answers

Answer:

It's not fair, said Angus." Tom's allowed to go, why can't I?"

Remember commas and apostrophes.

Which of the following is the main reason that eating local food helps the environment? (Please help!!)

A. It travels more miles.
B. It is less nutritious.
C. It is more nutritious.
D. It travels fewer miles.

Answers

Uh I think it could possibly be D

The fundamental reason why consuming locally produced food is beneficial to the environment is given in option (D): " It travels fewer miles"

What are the benefits of eating local food?

Local food helps to keep the local economy afloat because local food does not have to travel as far to reach your plate, it contributes to lowering greenhouse gas (GG) emissions and improving our carbon footprint.

It improves and aids the local economy by supporting local producers, farmers, and other producers.

Check out the link below to learn more about local-food benefits;

https://brainly.com/question/20898394

#SPJ2

"Think of all the beauty that’s still left in and around you and be happy."
—from The Diary of Anne Frank by Anne Frank

Even in difficult circumstances, some people focus on the positive aspects of life. Think carefully about this statement.

Write an essay stating your opinion on whether a person can choose to be happy. Be sure to —
• state your position clearly
• use appropriate organization
• provide specific support for your argument
• choose your words carefully
• edit your writing for grammar, mechanics, and spelling


Answers

Answer:

A person can absolutely choose to be happy. It is often easy to look at someone like Anne Frank and say that she was in a situation where one can't be happy. But, Anne Frank has showed us that happiness is not reliant upon circumstance. In incredibly difficult circumstances one has every right to feel negative emotions. The most important thing is that we remember that even though we experience negative emotions we shouldn't let them overrun us. We should accept our circumstances, experience our emotions,and then choose happiness.

N . R . Narayan Murthy is a pioneer in which field​

Answers

Answer:

Information Technology

Explanation:

https://en.wikipedia.org/wiki/N._R._Narayana_Murthy

Nagavara Ramarao Narayana Murthy (born 20 August 1946) is an Indian billionaire businessman. He is the founder of Infosys, and has been the chairman, chief executive officer (CEO), president, and chief mentor of the company before retiring and taking the title chairman emeritus.

https://en.wikipedia.org/wiki/Infosys

Infosys Limited is an Indian multinational information technology company that provides business consulting, information technology and outsourcing services.

Hi you can help me pliss

Answers

badly = in an unsuccessful way

alright = satisfied/okay

hooray = expresses joy and approval

on the radio = you heard it on the radio

see you soon = will meet again soon

5.
Choose the correct verb form to complete the sentence.

All of the painters _____ bold brush strokes.


A. uses


B. use

Answers

the answer is B. use

The students were interviewed by the reporter


Rewrite the sentence using active voice.

Answers

Answer:

The reporter had interviewed the students

the reporter interviewed the students

How can you show emotion in formal writing?\
by using question marks

by using emoticons

by using exclamation points

by using periods

plsssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss answer with one of the options

Answers

Answer:

by using exclamation points

Explanation:

Formal writings are writing styles adopted for use in professional, academic and other setting which does not involve a personal level of interaction. Therefore, formal writing setup are more organized and guided than informal writings. In formal writeups, there may also be need to show emotions such as excitement, happiness, surprise a d so on. If it were in an in formal setting the use of emoticons would be a very good way to show emotions due to the various emoticon labels available. However, the use of an exclamation mark (!) may be adopted in formal writing to express emotions. In many texts, the use of one (!) rather than three (!!!) is more appropriate for formal writings.

Need help with and essssayyyyyyyyy

Answers

Answer:

Essay on a story called "David Copperfield"

The full title of “David Copperfield” is “The Personal History, Adventures, Experience and Observation of David Copperfield the younger of Blunderstone Rookery” but it was never published under this name. “David Copperfield” is the story of a child carrying the same name and his journey from childhood till he grows old.

A sad childhood is portrayed in the story where the child loses his father at a young age. As a result, his mother marries again and his step father gives the little child a very hard time. His step father believes that being weak in studies, David needs full attention. After being frustrated by his father, little David one day bites him. The result is that soon he lands into a hostel where he also faces a hard time but makes two friends- James Steerforth and Tommy Traddles. When he returns home during vacations he comes to know that his mother has given birth to a baby boy. Soon both his mother and the baby boy dies and David is left alone to face the torture of his father. His father now sends David to a factory to work.

David runs away from London to Dover and now meets his relative, Aunt Betsey Trotwood. He is now renamed as Trotwood Copperfield and is addressed by the new nickname Trot everywhere. As he grows up many of his loved ones also leave him alone by kissing death including his Aunt Betsey. At a very young age David faces the pain that people do not face in their lifetimes. This makes him a mature and well to do individual. But life takes a much harder lesson after he gets married to Dora Spenlow because she dies facing the pain of her miscarriage early in their marriage. Later David marries the beautiful and sensible Agnes and lives a beautiful life with her and their three children. He also names his daughter after his late aunt Betsey to show how much he loved her and how much he still misses her.

Is this story okay ??if you want an essay on the story which you read ,then please ask , if I know the story I would try to help

Thank you

The girls (talk) during the class yesterday.
____________________________________________________
b) My sisters (laugh) at my story.
____________________________________________________
c) While he (clean) the house, we (cook).
____________________________________________________
d) It was a lovely day. The sun (shine) and the birds (sing) in the trees.
____________________________________________________
e) I lost my keys when I (walk) home.
____________________________________________________
f) I (knit) sweater when the puppy took away the ball of wool.
____________________________________________________
g) Papa (drink) tea when the newspaper boy arrived.
____________________________________________________
h) Talha (watch) TV when the phone rang.
____________________________________________________
i) Shan (drive) fast when he hit the woman.
____________________________________________________
j) When I woke up, it (rain).
____________________________________________________
k) I (have) dinner when I heard a loud noise.
______________________________
convert into past continious

Answers

Answer:

A) Talked

B) Laughed

C) cooked

D)  Shined

E) walked

F) knitted

G) Drank

H) Watched

I) Drove

J) Rained

K) Had

MARK THIS ANSWER AS BRAINLIEST PLEASE!

The girls were talking during the class yesterday.

My sisters was laughing at my story.

While he was cleaning the house, we were cooking.

It was a lovely day. The sun was shining and the birds were singing in the trees.

I lost my keys when I was walking home.

I was knitting sweater when the puppy took away the ball of wool.

Papa was drinking tea when the newspaper boy arrived.

Talha was watching TV when the phone rang.

Shan was driving fast when he hit the woman.

When I woke up, it was raining.

I was having dinner when I heard a loud noise.

How does the text "Cornerstone of Civil Rights" support the idea that racism influenced decisions made in the founding of the United States?

Answers

Answer and Explanation:

The text shows how it was necessary for a constitutional mandate to be created to ensure that the African American population was seen as American citizens and had access to basic rights such as freedom and life. This was the 14th amendment that was created long after the founding of the USA. The text shows that this amendment needed to be created, because the country was formed with a highly racist base, where the concepts of freedoms, rights and social duties were only promoted to the white population, and blacks did not have access to this, as they were considered unworthy, even in a country that has become independent in its quest for freedom and justice.

In other words, "Cornerstone of Civil Rights" shows that it was necessary for the equality and basic rights of the Afro-American population to become a federal law, in order to guarantee that blacks had a minimum quality of life, because the country devalued this population of very intensely at the time of its conception.

do well; do what you tried to do

Answers

yeah what he said yea

PART A: What impact does the figurative language used to describe Echo's love for
Narcissus in paragraph 3 have on the overall meaning of the text?
A.
The text describes Echo as burning, being inflamed with her love for Narcissus;
this contributes to the myth's meaning about consuming and dangerous love.
B.
The text describes Echo's love as draining, like water being sucked from the
earth; this contributes to the message warning against sudden infatuation.
C. The text describes Echo's love as shallow, like the waters of a spring this
contribute to the text's meaning regarding beauty and crushes.
D. The text describes Echo's love as painful, even before she is rejected; this
contributes to the myth's meaning about tragic love.

Answers

Answer:

a

Explanation:

because its the right blood

Figurative language is a way of expressing oneself that does not use a word's strict or realistic meaning. The correct option is A:- The text describes Echo as burning, being inflamed with her love for Narcissus

What impact does the figurative language use to describe Echo's love?

Despite the harshness of his rejection, Echo's love for Narcissus only grew.

Narcissus died, wasting away before his reflection, consumed by a love that could not be, Echo mourned over his body.

For more information about Figurative language, refer to the link:-

brainly.com/question/26891792

Other Questions
4. Temperature graphs from two cities on July 1 are shown below. Which statement is true?O A. City A experienced a bigger temperature change than City B.O B. City B experienced a bigger temperature change than City A.O C. The low temperature in City B was lower than the low temperature in City A.O D. Both B and C are true. she cooked rice passive I also need help with this one first 5 terms in a number sequence 0.5 1 2 4 8 A) write down the term to term ruleb) 7th term of sequencec) why cant 1527 be a term of the sequence Which circuit component usually acts as a switch or amplifier?O A. A transistorO B. A capacitorO C. A resistorD. A battery Helppppppppppppppppppppppppppppp!!!!!!!!! can yall please help im very slow London is going to invest $8.8oo and leave it in an account for 10 years.Assuming the interest is compounded continuously, what interest rate, to thenearest hundredth of a percent, would be required in order for London toend up with $13.400? Now imagine that a beam of moving electrons enters the quadrupole, with velocity parallel to the charged rods. When the beam enters the device, its cross-sectional profile is circular. What will the beam look like when it exits the quadrupole on the other side helpp mee pleaseeee need help A vault contains 3000 worth of nickels.How many nickels are in the vault Compare and contrast Presidential Reconstruction with Congressional Reconstruction, including the significance of Lincoln's assassination and Johnson's impeachment. Which is an appropriate element of a stress-management plan?limiting social interactionsreducing daily exerciseidentifying coping strategiesavoiding opportunities to have fun In triangle ABC, A = 38 and B = C. Find B.A)71B)26C)142 Can somebody help me Which of the following best descifrar the graph shown below? What happens to an electroscope when a negatively charged rod is brought close to the metal sphere at the top? Question 5 of 10Which of the following sentences is punctuated correctly?A. I think, you should have taken the dog for a walk.B. Those are his not mine.C. By the way your garbage can is in the street.O D. Furthermore, you left the groceries outside.SUBMITEnglish You gave one third of a pan of brownies to Sally and one sixth to Fletcher. What fraction of the pan of brownies remained? Write your answer as a proper fraction. Abby can buy an 4-pound bag of dog food for $4.08 or a 9-pound bag of the same dog food for $6.93. Which is the better buy?